Lineage for d1dcfa_ (1dcf A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1838037Family c.23.1.2: Receiver domain of the ethylene receptor [52194] (1 protein)
    automatically mapped to Pfam PF00072
  6. 1838038Protein Receiver domain of the ethylene receptor [52195] (1 species)
  7. 1838039Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [52196] (1 PDB entry)
  8. 1838040Domain d1dcfa_: 1dcf A: [31124]

Details for d1dcfa_

PDB Entry: 1dcf (more details), 2.5 Å

PDB Description: crystal structure of the receiver domain of the ethylene receptor of arabidopsis thaliana
PDB Compounds: (A:) etr1 protein

SCOPe Domain Sequences for d1dcfa_:

Sequence, based on SEQRES records: (download)

>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
hmsnftglkvlvmdengvsrmvtkgllvhlgcevttvssneeclrvvshehkvvfmdvcm
pgvenyqialrihekftkqrhqrpllvalsgntdkstkekcmsfgldgvllkpvsldnir
dvlsdlleprvlye

Sequence, based on observed residues (ATOM records): (download)

>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
hmsnftglkvlvmdengvsrmvtkgllvhlgcevttvssneeclrvvshehkvvfmdvcm
pgvenyqialrihekftqrhqrpllvalsgntdkstkekcmsfgldgvllkpvsldnird
vlsdlleprvlye

SCOPe Domain Coordinates for d1dcfa_:

Click to download the PDB-style file with coordinates for d1dcfa_.
(The format of our PDB-style files is described here.)

Timeline for d1dcfa_: