Lineage for d1dc3a1 (1dc3 A:0-148,A:313-330)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 976724Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 976928Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 976984Species Escherichia coli [TaxId:562] [51802] (9 PDB entries)
    Uniprot P06977
  8. 977000Domain d1dc3a1: 1dc3 A:0-148,A:313-330 [29958]
    Other proteins in same PDB: d1dc3a2, d1dc3b2

Details for d1dc3a1

PDB Entry: 1dc3 (more details), 2.5 Å

PDB Description: structural analysis of glyceraldehyde 3-phosphate dehydrogenase from escherichia coli: direct evidence for substrate binding and cofactor-induced conformational changes
PDB Compounds: (A:) glyceraldehyde 3-phosphate dehydrogenase

SCOPe Domain Sequences for d1dc3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dc3a1 c.2.1.3 (A:0-148,A:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]}
tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
pskdntpmfvkganfdkyagqdivsnasXnetgysnkvldliahisk

SCOPe Domain Coordinates for d1dc3a1:

Click to download the PDB-style file with coordinates for d1dc3a1.
(The format of our PDB-style files is described here.)

Timeline for d1dc3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dc3a2