Lineage for d1dar_3 (1dar 476-599)
- Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds) 
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossoverSuperfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) 
Family d.14.1.1: Translational machinery components [54212] (4 proteins) 
Protein Elongation factor G (EF-G), domain IV [54213] (1 species) Species Thermus thermophilus [TaxId:274] [54214] (6 PDB entries) 
Domain d1dar_3: 1dar 476-599 [37547]
Other proteins in same PDB: d1dar_1, d1dar_2, d1dar_4
complexed with gdp
Details for d1dar_3
PDB Entry: 1dar (more details), 2.4 Å
PDB Description: elongation factor g in complex with gdp
SCOP Domain Sequences for d1dar_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dar_3 d.14.1.1 (476-599) Elongation factor G (EF-G), domain IV {Thermus thermophilus}
vgkpqvayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvip
keyipavqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavq
kgdp
SCOP Domain Coordinates for d1dar_3:
Click to download the PDB-style file with coordinates for d1dar_3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dar_3:
- d1dar_3 first appeared (with stable ids) in SCOP 1.55
- d1dar_3 appears in SCOP 1.69
- d1dar_3 is called d1dara3 in SCOP 1.73
- d1dar_3 appears in the current release, SCOPe 2.08, called d1dara3
View in 3D
