Lineage for d1d9xa2 (1d9x A:415-595)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2478770Family c.37.1.19: Tandem AAA-ATPase domain [81268] (27 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2478857Protein Nucleotide excision repair enzyme UvrB [52708] (2 species)
    contains large insertions in the first AAA domain
  7. 2478858Species Bacillus caldotenax [TaxId:1395] [52710] (4 PDB entries)
    Uniprot P56981
  8. 2478864Domain d1d9xa2: 1d9x A:415-595 [32420]
    complexed with zn

Details for d1d9xa2

PDB Entry: 1d9x (more details), 2.6 Å

PDB Description: crystal structure of the dna repair protein uvrb
PDB Compounds: (A:) excinuclease uvrabc component uvrb

SCOPe Domain Sequences for d1d9xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d9xa2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]}
tglldptidvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvay
lhseiktlerieiirdlrlgkydvlvginllregldipevslvaildadkegflrsersl
iqtigraarnanghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeird
v

SCOPe Domain Coordinates for d1d9xa2:

Click to download the PDB-style file with coordinates for d1d9xa2.
(The format of our PDB-style files is described here.)

Timeline for d1d9xa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d9xa1