Lineage for d1d8da_ (1d8d A:)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) 
Family a.118.6.1: Protein prenylyltransferase [48440] (3 proteins) Protein Protein farnesyltransferase alpha-subunit [48441] (2 species) 
Species Norway rat (Rattus norvegicus) [TaxId:10116] [48442] (51 PDB entries)
Uniprot Q04631 55-369
Domain d1d8da_: 1d8d A: [19185]
Other proteins in same PDB: d1d8db_
complex with K-ras4b peptide substrate
complexed with act, fii, zn
Details for d1d8da_
PDB Entry: 1d8d (more details), 2 Å
PDB Description: co-crystal structure of rat protein farnesyltransferase complexed with a k-ras4b peptide substrate and fpp analog at 2.0a resolution
PDB Compounds: (A:) farnesyltransferase (alpha subunit)SCOPe Domain Sequences for d1d8da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d8da_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhsresdipasv
SCOPe Domain Coordinates for d1d8da_:
Click to download the PDB-style file with coordinates for d1d8da_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d8da_:
- d1d8da_ first appeared (with stable ids) in SCOP 1.55
- d1d8da_ appears in SCOPe 2.05
- d1d8da_ appears in SCOPe 2.07
- d1d8da_ appears in the current release, SCOPe 2.08
View in 3D
