Lineage for d1d7la1 (1d7l A:1-173,A:276-394)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meanderSuperfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) 
Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
C-terminal domain is alpha+beta is common for the family
Protein p-Hydroxybenzoate hydroxylase, PHBH [51917] (2 species) Species Pseudomonas aeruginosa [TaxId:287] [51919] (18 PDB entries) 
Domain d1d7la1: 1d7l A:1-173,A:276-394 [30364]
Other proteins in same PDB: d1d7la2
complexed with phb, rfl, so4
Details for d1d7la1
PDB Entry: 1d7l (more details), 2.2 Å
PDB Description: structure-function correlations of the reaction of reduced nicotinamide analogs with p-hydroxybenzoate hydroxylase substituted with a series of 8-substituted flavins
PDB Compounds: (A:) p-hydroxybenzoate hydroxylaseSCOPe Domain Sequences for d1d7la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d7la1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]}
mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgriragvleqgmvdllreag
vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareacgatt
vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerXmqhgrl
flagdaahivpptgakglnlaasdvstlyrlllkayregrgellerysaiclrriwkaer
fswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglpyeeie
SCOPe Domain Coordinates for d1d7la1:
Click to download the PDB-style file with coordinates for d1d7la1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d7la1:
- d1d7la1 first appeared (with stable ids) in SCOP 1.55
- d1d7la1 appears in SCOPe 2.04
- d1d7la1 appears in SCOPe 2.06
- d1d7la1 appears in the current release, SCOPe 2.08
View in 3D
