Lineage for d1d5wb_ (1d5w B:)
- Root: SCOPe 2.02
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345Superfamily c.23.1: CheY-like [52172] (8 families) 
Family c.23.1.1: CheY-related [52173] (26 proteins) 
Protein Transcriptional regulatory protein FixJ, receiver domain [52182] (1 species) Species Rhizobium meliloti [TaxId:382] [52183] (4 PDB entries) 
Domain d1d5wb_: 1d5w B: [31100]
phosphorylated form
complexed with so4
Details for d1d5wb_
PDB Entry: 1d5w (more details), 2.3 Å
PDB Description: phosphorylated fixj receiver domain
PDB Compounds: (B:) transcriptional regulatory protein fixjSCOPe Domain Sequences for d1d5wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d5wb_ c.23.1.1 (B:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]}
mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdm
sgvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierase
hl
SCOPe Domain Coordinates for d1d5wb_:
Click to download the PDB-style file with coordinates for d1d5wb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d5wb_:
- d1d5wb_ first appeared (with stable ids) in SCOP 1.55
- d1d5wb_ appears in SCOPe 2.01
- d1d5wb_ appears in SCOPe 2.03
- d1d5wb_ appears in the current release, SCOPe 2.08
View in 3D
