Lineage for d1d4m1_ (1d4m 1:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1334432Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1334633Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 1334634Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 1334654Protein Human enterovirus B coat proteins [88635] (4 species)
  7. 1334655Species Human coxsackievirus A9 [TaxId:12067] [49683] (1 PDB entry)
  8. 1334657Domain d1d4m1_: 1d4m 1: [23567]
    complexed with myr, w71

Details for d1d4m1_

PDB Entry: 1d4m (more details), 2.9 Å

PDB Description: the crystal structure of coxsackievirus a9 to 2.9 a resolution
PDB Compounds: (1:) protein (coxsackievirus a9)

SCOPe Domain Sequences for d1d4m1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d4m1_ b.121.4.1 (1:) Human enterovirus B coat proteins {Human coxsackievirus A9 [TaxId: 12067]}
gdveeaieravvhvadtmrsgpsnsasvpaltavetghtsqvtpsdtmqtrhvknyhsrs
estvenflgrsacvymeeykttdndvnkkfvawpintkqmvqmrrklemftylrfdmevt
fvitsrqdpgttlaqdmpvlthqimyvppggpipakvddyawqtstnpsifwtegnapar
msipfisignaysnfydgwsnfdqrgsygyntlnnlghiyvrhvsgssphpitstirvyf
kpkhtrawvprpprlcqykkafsvdftptpitdtrkdintvttv

SCOPe Domain Coordinates for d1d4m1_:

Click to download the PDB-style file with coordinates for d1d4m1_.
(The format of our PDB-style files is described here.)

Timeline for d1d4m1_: