Lineage for d1d0xa1 (1d0x A:34-79)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) 
Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein) Protein Myosin S1 fragment, N-terminal domain [50086] (4 species) Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (21 PDB entries) 
Domain d1d0xa1: 1d0x A:34-79 [24583]
Other proteins in same PDB: d1d0xa2
complexed with mg, mnq
Details for d1d0xa1
PDB Entry: 1d0x (more details), 2 Å
PDB Description: dictyostelium myosin s1dc (motor domain fragment) complexed with m- nitrophenyl aminoethyldiphosphate beryllium trifluoride.
PDB Compounds: (A:) myosin s1dc motor domainSCOPe Domain Sequences for d1d0xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d0xa1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
yiwynpdpkerdsyecgeivsetsdsftfktvdgqdrqvkkddanq
SCOPe Domain Coordinates for d1d0xa1:
Click to download the PDB-style file with coordinates for d1d0xa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d0xa1:
- d1d0xa1 first appeared (with stable ids) in SCOP 1.55
- d1d0xa1 appears in SCOPe 2.05
- d1d0xa1 appears in SCOPe 2.07
- d1d0xa1 appears in the current release, SCOPe 2.08
View in 3D
