Lineage for d1cyda_ (1cyd A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
    has additional subdomain(s) that are not in the common domain
  6. 2841697Protein Carbonyl reductase [51765] (2 species)
  7. 2841701Species Mouse (Mus musculus) [TaxId:10090] [51766] (1 PDB entry)
  8. 2841702Domain d1cyda_: 1cyd A: [29825]
    complexed with ipa, ndp

Details for d1cyda_

PDB Entry: 1cyd (more details), 1.8 Å

PDB Description: carbonyl reductase complexed with nadph and 2-propanol
PDB Compounds: (A:) carbonyl reductase

SCOPe Domain Sequences for d1cyda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]}
lnfsglralvtgagkgigrdtvkalhasgakvvavtrtnsdlvslakecpgiepvcvdlg
dwdatekalggigpvdllvnnaalvimqpflevtkeafdrsfsvnlrsvfqvsqmvardm
inrgvpgsivnvssmvahvtfpnlitysstkgamtmltkamamelgphkirvnsvnptvv
ltdmgkkvsadpefarklkerhplrkfaevedvvnsilfllsdrsastsgggilvdagyl
as

SCOPe Domain Coordinates for d1cyda_:

Click to download the PDB-style file with coordinates for d1cyda_.
(The format of our PDB-style files is described here.)

Timeline for d1cyda_: