![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) ![]() |
![]() | Family b.121.4.5: Bromoviridae-like VP [88639] (2 proteins) |
![]() | Protein Cucumovirus coat protein [88640] (4 species) |
![]() | Species Cowpea chlorotic mottle virus [TaxId:12303] [49636] (1 PDB entry) |
![]() | Domain d1cwpb_: 1cwp B: [23306] protein/RNA complex |
PDB Entry: 1cwp (more details), 3.2 Å
SCOPe Domain Sequences for d1cwpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cwpb_ b.121.4.5 (B:) Cucumovirus coat protein {Cowpea chlorotic mottle virus [TaxId: 12303]} vvqpvivepiasgqgkaikawtgysvskwtascaaaeakvtsaitislpnelssernkql kvgrvllwlgllpsvsgtvkscvtetqttaaasfqvalavadnskdvvaamypeafkgit leqlaadltiylyssaaltegdvivhlevehvrptfddsftpvy
Timeline for d1cwpb_: