Lineage for d1cvra1 (1cvr A:351-432)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strandsSuperfamily b.1.18: E set domains [81296] (24 families) 
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.12: Gingipain R (RgpB), C-terminal domain [81292] (1 protein)
automatically mapped to Pfam PF03785Protein Gingipain R (RgpB), C-terminal domain [49261] (1 species)
Arginine-specific cysteine proteinase
follows the catalytic alpha/beta domainsSpecies Porphyromonas gingivalis [TaxId:837] [49262] (1 PDB entry) 
Domain d1cvra1: 1cvr A:351-432 [21949]
Other proteins in same PDB: d1cvra2
complexed with ca, h37, zn
Details for d1cvra1
PDB Entry: 1cvr (more details), 2 Å
PDB Description: Crystal structure of the Arg specific cysteine proteinase gingipain R (RGPB)
PDB Compounds: (A:) gingipain rSCOPe Domain Sequences for d1cvra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cvra1 b.1.18.12 (A:351-432) Gingipain R (RgpB), C-terminal domain {Porphyromonas gingivalis [TaxId: 837]}
ptemqvtapanisasaqtfevacdyngaiatlsddgdmvgtaivkdgkaiiklnesiade
tnltltvvgynkvtvikdvkve
SCOPe Domain Coordinates for d1cvra1:
Click to download the PDB-style file with coordinates for d1cvra1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cvra1:
- d1cvra1 first appeared (with stable ids) in SCOP 1.55
- d1cvra1 appears in SCOPe 2.04
- d1cvra1 appears in SCOPe 2.06
- d1cvra1 appears in the current release, SCOPe 2.08
View in 3D
