Lineage for d1ctx__ (1ctx -)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 622608Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 622609Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 622610Family g.7.1.1: Snake venom toxins [57303] (24 proteins)
  6. 622611Protein alpha-Cobratoxin [57318] (2 species)
  7. 622612Species Cobra (Naja naja siamensis) [57319] (2 PDB entries)
  8. 622614Domain d1ctx__: 1ctx - [44421]

Details for d1ctx__

PDB Entry: 1ctx (more details), 2.8 Å

PDB Description: three-dimensional structure of the-long-neurotoxin from cobra venom

SCOP Domain Sequences for d1ctx__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ctx__ g.7.1.1 (-) alpha-Cobratoxin {Cobra (Naja naja siamensis)}
ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
ncnpfptrkrp

SCOP Domain Coordinates for d1ctx__:

Click to download the PDB-style file with coordinates for d1ctx__.
(The format of our PDB-style files is described here.)

Timeline for d1ctx__: