Lineage for d1ctja_ (1ctj A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760650Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 760651Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 760652Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 760781Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (10 species)
  7. 760814Species Monoraphidium braunii [TaxId:34112] [46630] (3 PDB entries)
  8. 760815Domain d1ctja_: 1ctj A: [15798]
    complexed with hem

Details for d1ctja_

PDB Entry: 1ctj (more details), 1.1 Å

PDB Description: crystal structure of cytochrome c6
PDB Compounds: (A:) cytochrome c6

SCOP Domain Sequences for d1ctja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ctja_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Monoraphidium braunii [TaxId: 34112]}
eadlalgkavfdgncaachagggnnvipdhtlqkaaieqfldggfnieaivyqiengkga
mpawdgrldedeiagvaayvydqaagnkw

SCOP Domain Coordinates for d1ctja_:

Click to download the PDB-style file with coordinates for d1ctja_.
(The format of our PDB-style files is described here.)

Timeline for d1ctja_: