Lineage for d1csza_ (1csz A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1918721Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1918722Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1918723Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1919080Protein Syk tyrosine kinase [55575] (1 species)
  7. 1919081Species Human (Homo sapiens) [TaxId:9606] [55576] (3 PDB entries)
  8. 1919094Domain d1csza_: 1csz A: [40520]
    C-terminal SH2 domain

Details for d1csza_

PDB Entry: 1csz (more details)

PDB Description: syk tyrosine kinase c-terminal sh2 domain complexed with a phosphopeptidefrom the gamma chain of the high affinity immunoglobin g receptor, nmr
PDB Compounds: (A:) syk protein tyrosine kinase

SCOPe Domain Sequences for d1csza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1csza_ d.93.1.1 (A:) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
gsrrasvgshekmpwfhgkisreeseqivligsktngkflirardnngsyalcllhegkv
lhyridkdktgklsipegkkfdtlwqlvehysykadgllrvltvpcqkigtq

SCOPe Domain Coordinates for d1csza_:

Click to download the PDB-style file with coordinates for d1csza_.
(The format of our PDB-style files is described here.)

Timeline for d1csza_: