Lineage for d1csp__ (1csp -)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 559685Superfamily b.40.4: Nucleic acid-binding proteins [50249] (13 families) (S)
  5. 559965Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
    barrel, closed; n=5, S=8
  6. 560008Protein Major cold shock protein [50283] (4 species)
  7. 560022Species Bacillus subtilis [TaxId:1423] [50285] (4 PDB entries)
  8. 560023Domain d1csp__: 1csp - [25321]

Details for d1csp__

PDB Entry: 1csp (more details), 2.5 Å

PDB Description: crystal structure of the bacillus subtilis major cold shock protein, cspb: a universal nucleic-acid binding domain

SCOP Domain Sequences for d1csp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1csp__ b.40.4.5 (-) Major cold shock protein {Bacillus subtilis}
mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa
anvtkea

SCOP Domain Coordinates for d1csp__:

Click to download the PDB-style file with coordinates for d1csp__.
(The format of our PDB-style files is described here.)

Timeline for d1csp__: