Lineage for d1crba_ (1crb A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2414378Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2414543Protein Cellular retinol-binding protein II (CRBP) [50864] (2 species)
  7. 2414544Species Norway rat (Rattus norvegicus) [TaxId:10116] [50865] (9 PDB entries)
  8. 2414551Domain d1crba_: 1crb A: [27220]
    complexed with cd, rtl

Details for d1crba_

PDB Entry: 1crb (more details), 2.1 Å

PDB Description: crystallographic studies on a family of cellular lipophilic transport proteins. refinement of p2 myelin protein and the structure determination and refinement of cellular retinol-binding protein in complex with all-trans-retinol
PDB Compounds: (A:) cellular retinol binding protein

SCOPe Domain Sequences for d1crba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1crba_ b.60.1.2 (A:) Cellular retinol-binding protein II (CRBP) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvdfngywkmlsnenfeeylraldvnvalrkianllkpdkeivqdgdhmiirtlstfrny
imdfqvgkefeedltgiddrkcmttvswdgdklqcvqkgekegrgwtqwiegdelhlemr
aegvtckqvfkkvh

SCOPe Domain Coordinates for d1crba_:

Click to download the PDB-style file with coordinates for d1crba_.
(The format of our PDB-style files is described here.)

Timeline for d1crba_: