Lineage for d1cqwa_ (1cqw A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1615834Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1615835Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1616432Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)
  6. 1616433Protein Haloalkane dehalogenase [53514] (3 species)
  7. 1616434Species Rhodococcus sp. [TaxId:1831] [53516] (3 PDB entries)
  8. 1616437Domain d1cqwa_: 1cqw A: [34679]
    complexed with iod

Details for d1cqwa_

PDB Entry: 1cqw (more details), 1.5 Å

PDB Description: nai cocrystallised with haloalkane dehalogenase from a rhodococcus species
PDB Compounds: (A:) haloalkane dehalogenase; 1-chlorohexane halidohydrolase

SCOPe Domain Sequences for d1cqwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqwa_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]}
igtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssylwrniiphvapshrcia
pdligmgksdkpdldyffddhvryldafiealgleevvlvihdwgsalgfhwakrnperv
kgiacmefirpiptwdewpefaretfqafrtadvgreliidqnafiegvlpkcvvrplte
vemdhyrepflkpvdreplwrfpneipiagepanivalveaymnwlhqspvpkllfwgtp
gvlippaeaarlaeslpncktvdigpglhylqednpdligseiarwlpglasglg

SCOPe Domain Coordinates for d1cqwa_:

Click to download the PDB-style file with coordinates for d1cqwa_.
(The format of our PDB-style files is described here.)

Timeline for d1cqwa_: