![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies) beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.100.1: L9 N-domain-like [55658] (3 families) ![]() |
![]() | Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein) automatically mapped to Pfam PF01281 |
![]() | Protein Ribosomal protein L9 N-domain [55660] (3 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [55661] (5 PDB entries) |
![]() | Domain d1cqua_: 1cqu A: [70073] N-domain only |
PDB Entry: 1cqu (more details)
SCOPe Domain Sequences for d1cqua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cqua_ d.100.1.1 (A:) Ribosomal protein L9 N-domain {Bacillus stearothermophilus [TaxId: 1422]} mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeqr
Timeline for d1cqua_: