Lineage for d1cqua_ (1cqu A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 869343Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 869344Superfamily d.100.1: L9 N-domain-like [55658] (2 families) (S)
  5. 869345Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
  6. 869346Protein Ribosomal protein L9 N-domain [55660] (3 species)
  7. 869347Species Bacillus stearothermophilus [TaxId:1422] [55661] (9 PDB entries)
  8. 869353Domain d1cqua_: 1cqu A: [70073]
    N-domain only

Details for d1cqua_

PDB Entry: 1cqu (more details)

PDB Description: solution structure of the n-terminal domain of ribosomal protein l9
PDB Compounds: (A:) 50S ribosomal protein L9

SCOP Domain Sequences for d1cqua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqua_ d.100.1.1 (A:) Ribosomal protein L9 N-domain {Bacillus stearothermophilus [TaxId: 1422]}
mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeqr

SCOP Domain Coordinates for d1cqua_:

Click to download the PDB-style file with coordinates for d1cqua_.
(The format of our PDB-style files is described here.)

Timeline for d1cqua_: