Lineage for d1cqpa_ (1cqp A:)
- Root: SCOPe 2.02
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.62: vWA-like [53299] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the restSuperfamily c.62.1: vWA-like [53300] (6 families) 
Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins) 
Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species) Species Human (Homo sapiens) [TaxId:9606] [53303] (25 PDB entries)
Uniprot P20701 153-334
Domain d1cqpa_: 1cqp A: [34127]
complexed with lovastatin
complexed with 803, mg
Details for d1cqpa_
PDB Entry: 1cqp (more details), 2.6 Å
PDB Description: crystal structure analysis of the complex lfa-1 (cd11a) i-domain / lovastatin at 2.6 a resolution
PDB Compounds: (A:) antigen cd11a (p180)SCOPe Domain Sequences for d1cqpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cqpa_ c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]}
gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
vi
SCOPe Domain Coordinates for d1cqpa_:
Click to download the PDB-style file with coordinates for d1cqpa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cqpa_:
- d1cqpa_ first appeared (with stable ids) in SCOP 1.55
- d1cqpa_ appears in SCOPe 2.01
- d1cqpa_ appears in SCOPe 2.03
- d1cqpa_ appears in the current release, SCOPe 2.08
View in 3D
