Lineage for d1cqka_ (1cqk A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species) 
Species Mouse (Mus musculus) [TaxId:10090] [88591] (2 PDB entries) 
Domain d1cqka_: 1cqk A: [21547]
CH-gamma-3 domain only from antibody MAK33
Details for d1cqka_
PDB Entry: 1cqk (more details), 2.2 Å
PDB Description: crystal structure of the ch3 domain from the mak33 antibody
PDB Compounds: (A:) ch3 domain of mak33 antibodySCOPe Domain Sequences for d1cqka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cqka_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus) [TaxId: 10090]}
paapqvytipppleqmakdlvsltcmitdffpeditvewqwngqpaenykntqpimdtdg
syfvysklnvqksnweagntftcsvlheglhnhhtekslsh
SCOPe Domain Coordinates for d1cqka_:
Click to download the PDB-style file with coordinates for d1cqka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cqka_:
- d1cqka_ first appeared (with stable ids) in SCOP 1.55
- d1cqka_ appears in SCOPe 2.07
View in 3D
