Lineage for d1cqeb2 (1cqe B:31-73)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1240201Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1240965Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 1240966Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1241249Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
    the rest of protein is heme-linked peroxidase, all-alpha fold
  7. 1241279Species Sheep (Ovis aries) [TaxId:9940] [57211] (20 PDB entries)
    Uniprot P05979 32-584
  8. 1241293Domain d1cqeb2: 1cqe B:31-73 [44247]
    Other proteins in same PDB: d1cqea1, d1cqeb1
    complexed with bog, flp, hem

Details for d1cqeb2

PDB Entry: 1cqe (more details), 3.1 Å

PDB Description: prostaglandin h2 synthase-1 complex with flurbiprofen
PDB Compounds: (B:) protein (prostaglandin h2 synthase-1)

SCOPe Domain Sequences for d1cqeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqeb2 g.3.11.1 (B:31-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}
apvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

SCOPe Domain Coordinates for d1cqeb2:

Click to download the PDB-style file with coordinates for d1cqeb2.
(The format of our PDB-style files is described here.)

Timeline for d1cqeb2:

1241293
d1cqeb2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1cqeb1