Lineage for d1cqaa_ (1cqa A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2576611Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 2576612Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
    automatically mapped to Pfam PF00235
  6. 2576613Protein Profilin (actin-binding protein) [55772] (8 species)
  7. 2576625Species Birch (Betula verrucosa) [TaxId:3505] [55778] (1 PDB entry)
  8. 2576626Domain d1cqaa_: 1cqa A: [40890]

Details for d1cqaa_

PDB Entry: 1cqa (more details), 2.4 Å

PDB Description: birch pollen profilin
PDB Compounds: (A:) Profilin

SCOPe Domain Sequences for d1cqaa_:

Sequence, based on SEQRES records: (download)

>d1cqaa_ d.110.1.1 (A:) Profilin (actin-binding protein) {Birch (Betula verrucosa) [TaxId: 3505]}
swqtyvdehlmcdidgqgeelaasaivghdgsvwaqsssfpqfkpqeitgimkdfeepgh
laptglhlggikymviqgeagavirgkkgsggitikktgqalvfgiyeepvtpgqcnmvv
erlgdylidqgl

Sequence, based on observed residues (ATOM records): (download)

>d1cqaa_ d.110.1.1 (A:) Profilin (actin-binding protein) {Birch (Betula verrucosa) [TaxId: 3505]}
swqtyvdehlmlaasaivghdgsvwaqsssfpqfkpqeitgimkdfeepghlaptglhlg
gikymviqgeagavirgkkgsggitikktgqalvfgiyeepvtpgqcnmvverlgdylid
qgl

SCOPe Domain Coordinates for d1cqaa_:

Click to download the PDB-style file with coordinates for d1cqaa_.
(The format of our PDB-style files is described here.)

Timeline for d1cqaa_: