Lineage for d1cpoa2 (1cpo A:120-298)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies)
core: 4 helices; array of 2 hairpins, opened
Superfamily a.39.3: Cloroperoxidase [47571] (1 family) 
duplication: consists of 2 similar domains composed of 2 EF hand-like motifs eachFamily a.39.3.1: Cloroperoxidase [47572] (1 protein) Protein Cloroperoxidase [47573] (1 species) Species Fungus (Caldariomyces fumago) [TaxId:5474] [47574] (13 PDB entries) 
Domain d1cpoa2: 1cpo A:120-298 [17391]
complexed with hem, man, mn, nag, xys
Details for d1cpoa2
PDB Entry: 1cpo (more details), 1.9 Å
PDB Description: chloroperoxidase
PDB Compounds: (A:) chloroperoxidaseSCOPe Domain Sequences for d1cpoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cpoa2 a.39.3.1 (A:120-298) Cloroperoxidase {Fungus (Caldariomyces fumago) [TaxId: 5474]}
nsndfidnrnfdaetfqtsldvvagkthfdyadmneirlqreslsneldfpgwfteskpi
qnvesgfifalvsdfnlpdndenplvridwwkywftnesfpyhlgwhppspareiefvts
assavlaasvtstpsslpsgaigpgaeavplsfastmtpfllatnapyyaqdptlgpnd
SCOPe Domain Coordinates for d1cpoa2:
Click to download the PDB-style file with coordinates for d1cpoa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cpoa2:
- d1cpoa2 first appeared (with stable ids) in SCOP 1.55, called d1cpo_2
- d1cpoa2 appears in SCOPe 2.07
View in 3D
