Lineage for d1cov3_ (1cov 3:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2086376Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2086604Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2086605Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2086625Protein Human enterovirus B coat proteins [88635] (4 species)
  7. 2086630Species Human coxsackievirus B3 [TaxId:12072] [49681] (2 PDB entries)
  8. 2086634Domain d1cov3_: 1cov 3: [23566]
    complexed with myr, plm

Details for d1cov3_

PDB Entry: 1cov (more details), 3.5 Å

PDB Description: coxsackievirus b3 coat protein
PDB Compounds: (3:) coxsackievirus coat protein

SCOPe Domain Sequences for d1cov3_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cov3_ b.121.4.1 (3:) Human enterovirus B coat proteins {Human coxsackievirus B3 [TaxId: 12072]}
glptmntpgscqfltsddfqspsampqydvtpemripgevknlmeiaevdsvvpvqnvge
kvnsmeayqipvrsnegsgtqvfgfplqpgyssvfsrtllgeilnyythwsgsikltfmf
cgsamatgkfllaysppgagaptkrvdamlgthvvwdvglqsscvlcipwisqthyryva
sdeytaggfitcwyqtnivvpadaqsscyimcfvsacndfsvrllkdtpfisqenffq

SCOPe Domain Coordinates for d1cov3_:

Click to download the PDB-style file with coordinates for d1cov3_.
(The format of our PDB-style files is described here.)

Timeline for d1cov3_: