Lineage for d1copd_ (1cop D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1732724Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1732725Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1732746Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 1732766Protein cro lambda repressor [47428] (1 species)
    the fourth helix is replaced with a beta hairpin
    3 helices; folded leaf, opened
  7. 1732767Species Bacteriophage lambda [TaxId:10710] [47429] (12 PDB entries)
  8. 1732785Domain d1copd_: 1cop D: [17058]

Details for d1copd_

PDB Entry: 1cop (more details)

PDB Description: three-dimensional dimer structure of the lambda-cro repressor in solution as determined by heteronuclear multidimensional nmr
PDB Compounds: (D:) cro repressor

SCOPe Domain Sequences for d1copd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1copd_ a.35.1.2 (D:) cro lambda repressor {Bacteriophage lambda [TaxId: 10710]}
meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfps
nkktta

SCOPe Domain Coordinates for d1copd_:

Click to download the PDB-style file with coordinates for d1copd_.
(The format of our PDB-style files is described here.)

Timeline for d1copd_:

1732785
d1copd_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1cope_