Lineage for d1cooa_ (1coo A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737577Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1737867Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 1737868Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (2 proteins)
  6. 1737869Protein C-terminal domain of RNA polymerase alpha subunit [47791] (4 species)
  7. 1737872Species Escherichia coli [TaxId:562] [47792] (2 PDB entries)
  8. 1737875Domain d1cooa_: 1coo A: [17967]

Details for d1cooa_

PDB Entry: 1coo (more details)

PDB Description: the cooh-terminal domain of rna polymerase alpha subunit
PDB Compounds: (A:) RNA polymerase alpha subunit

SCOPe Domain Sequences for d1cooa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cooa_ a.60.3.1 (A:) C-terminal domain of RNA polymerase alpha subunit {Escherichia coli [TaxId: 562]}
fdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikdvla
srglslgmrlenwppasiade

SCOPe Domain Coordinates for d1cooa_:

Click to download the PDB-style file with coordinates for d1cooa_.
(The format of our PDB-style files is described here.)

Timeline for d1cooa_: