Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
Protein Cytochrome P450-NOR, nitric reductase [48270] (1 species) |
Species Fungus (Fusarium oxysporum) [TaxId:5507] [48271] (25 PDB entries) Uniprot P23295 |
Domain d1cmna_: 1cmn A: [18958] complexed with hem, no; mutant |
PDB Entry: 1cmn (more details), 1.7 Å
SCOPe Domain Sequences for d1cmna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cmna_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr trqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarea saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnatm vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtavalaikrtakedvmigdkl vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif
Timeline for d1cmna_: