Lineage for d1cmla1 (1cml A:1-235)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the restSuperfamily c.95.1: Thiolase-like [53901] (3 families) 
Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins) Protein Chalcone synthase [53915] (1 species) Species Alfalfa (Medicago sativa) [TaxId:3879] [53916] (16 PDB entries)
Uniprot P30074
Domain d1cmla1: 1cml A:1-235 [35989]
complexed with mlc, pin, so4
Details for d1cmla1
PDB Entry: 1cml (more details), 1.69 Å
PDB Description: chalcone synthase from alfalfa complexed with malonyl-coa
PDB Compounds: (A:) protein (chalcone synthase)SCOPe Domain Sequences for d1cmla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cmla1 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]}
mvsvseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmc
dksmikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqp
kskithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgafaggtvlrlakdlaen
nkgarvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekp
SCOPe Domain Coordinates for d1cmla1:
Click to download the PDB-style file with coordinates for d1cmla1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cmla1:
View in 3D
