![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein cAMP-dependent PK, catalytic subunit [56116] (4 species) AGC group; PKA subfamily; serine/threonine kinase |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [56117] (9 PDB entries) |
![]() | Domain d1cmke_: 1cmk E: [41623] complexed with iod, myr |
PDB Entry: 1cmk (more details), 2.9 Å
SCOPe Domain Sequences for d1cmke_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cmke_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Pig (Sus scrofa) [TaxId: 9823]} gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv khketgnhfamkildkqkvvklkqiehtlnekrilqavnfpflvkleysfkdnsnlymvm eyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfatt dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
Timeline for d1cmke_: