Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily) corner-like structure formed by two sheets and filled in with 2-3 helices |
Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold |
Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins) note: the solution structure determinations disagree in the relative orientations of two motifs |
Protein Soluble methane monooxygenase regulatory protein B [56031] (3 species) |
Species Escherichia coli [TaxId:562] [56032] (1 PDB entry) |
Domain d1ckva_: 1ckv A: [41452] |
PDB Entry: 1ckv (more details)
SCOPe Domain Sequences for d1ckva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ckva_ d.137.1.1 (A:) Soluble methane monooxygenase regulatory protein B {Escherichia coli [TaxId: 562]} msvnsnaydagimglkgkdfadqffadenqvvhesdtvvlvlkksdeintfieeilltdy kknvnptvnvedragywwikangkievdcdeisellgrqfnvydflvdvsstigraytlg nkftitselmgldrkledyha
Timeline for d1ckva_: