Lineage for d1ckia_ (1cki A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein Casein kinase-1, CK1 [56139] (4 species)
    OPK group; CKI subfamily; serine/threonine kinase
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [56140] (2 PDB entries)
  8. Domain d1ckia_: 1cki A: [41660]
    mutant

Details for d1ckia_

PDB Entry: 1cki (more details), 2.3 Å

PDB Description: recombinant casein kinase i delta truncation mutant containing residues 1-317
PDB Compounds: (A:) casein kinase I delta

SCOPe Domain Sequences for d1ckia_:

Sequence, based on SEQRES records: (download)

>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
melrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmq
ggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyih
sknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtarya
sinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievl
ckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlkfgasr

Sequence, based on observed residues (ATOM records): (download)

>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
melrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmq
ggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyih
sknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtarya
sinthlgieqsrrddleslgyvlmyfnlgslpwqglkyerisekkmstpievlckgypse
fatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlkfgasr

SCOPe Domain Coordinates for d1ckia_ are not available.

Timeline for d1ckia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ckib_