Lineage for d1ckea_ (1cke A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987026Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 987092Protein CMP kinase [52548] (3 species)
  7. 987093Species Escherichia coli [TaxId:562] [52549] (6 PDB entries)
  8. 987094Domain d1ckea_: 1cke A: [31846]
    complexed with so4

Details for d1ckea_

PDB Entry: 1cke (more details), 1.75 Å

PDB Description: cmp kinase from escherichia coli free enzyme structure
PDB Compounds: (A:) protein (cytidine monophosphate kinase)

SCOPe Domain Sequences for d1ckea_:

Sequence, based on SEQRES records: (download)

>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]}
aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqvkgfsvnferllaeikerd
drdrnravaplvpaadalvldsttlsieqviekalqyarqklala

Sequence, based on observed residues (ATOM records): (download)

>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]}
aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqvkgfsvnferllaeiklvp
aadalvldsttlsieqviekalqyarqklala

SCOPe Domain Coordinates for d1ckea_:

Click to download the PDB-style file with coordinates for d1ckea_.
(The format of our PDB-style files is described here.)

Timeline for d1ckea_: