Lineage for d1chka_ (1chk A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1632226Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1632227Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1633940Family d.2.1.7: Chitosanase [53996] (2 proteins)
    automatically mapped to Pfam PF01374
  6. 1633941Protein Endochitosanase [53997] (2 species)
  7. 1633945Species Streptomyces sp., strain N174 [TaxId:1931] [53998] (1 PDB entry)
  8. 1633946Domain d1chka_: 1chk A: [36999]

Details for d1chka_

PDB Entry: 1chk (more details), 2.4 Å

PDB Description: streptomyces n174 chitosanase ph5.5 298k
PDB Compounds: (A:) Chitosanase

SCOPe Domain Sequences for d1chka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1chka_ d.2.1.7 (A:) Endochitosanase {Streptomyces sp., strain N174 [TaxId: 1931]}
agaglddphkkeiamelvssaenssldwkaqykyiedigdgrgytggiigfcsgtgdmle
lvqhytdlepgnilakylpalkkvngsashsglgtpftkdwataakdtvfqqaqnderdr
vyfdpavsqakadglralgqfayydaivmhgpgndptsfggirktamkkartpaqggdet
tylngfldarkaamlteaahddtsrvdteqrvflkagnldlnpplkwktygdpyvins

SCOPe Domain Coordinates for d1chka_:

Click to download the PDB-style file with coordinates for d1chka_.
(The format of our PDB-style files is described here.)

Timeline for d1chka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1chkb_