| Class g: Small proteins [56992] (90 folds) |
| Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (6 families) ![]() |
| Family g.44.1.1: RING finger domain, C3HC4 [57851] (14 proteins) |
| Protein Immediate early protein, IEEHV [57856] (1 species) |
| Species Equine herpesvirus 1 [TaxId:10326] [57857] (1 PDB entry) |
| Domain d1chca_: 1chc A: [45323] complexed with zn |
PDB Entry: 1chc (more details)
SCOP Domain Sequences for d1chca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]}
matvaercpicledpsnysmalpclhafcyvcitrwirqnptcplckvpvesvvhtiesd
sefgdqli
Timeline for d1chca_: