Lineage for d1chca_ (1chc A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 893809Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 893810Superfamily g.44.1: RING/U-box [57850] (6 families) (S)
  5. 893811Family g.44.1.1: RING finger domain, C3HC4 [57851] (14 proteins)
  6. 893836Protein Immediate early protein, IEEHV [57856] (1 species)
  7. 893837Species Equine herpesvirus 1 [TaxId:10326] [57857] (1 PDB entry)
  8. 893838Domain d1chca_: 1chc A: [45323]
    complexed with zn

Details for d1chca_

PDB Entry: 1chc (more details)

PDB Description: structure of the c3hc4 domain by 1h-nuclear magnetic resonance spectroscopy; a new structural class of zinc-finger
PDB Compounds: (A:) equine herpes virus-1 ring domain

SCOP Domain Sequences for d1chca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]}
matvaercpicledpsnysmalpclhafcyvcitrwirqnptcplckvpvesvvhtiesd
sefgdqli

SCOP Domain Coordinates for d1chca_:

Click to download the PDB-style file with coordinates for d1chca_.
(The format of our PDB-style files is described here.)

Timeline for d1chca_: