Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Cathepsin G [50548] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50549] (4 PDB entries) |
Domain d1cgha_: 1cgh A: [26290] complexed with 1zg |
PDB Entry: 1cgh (more details), 1.8 Å
SCOPe Domain Sequences for d1cgha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cgha_ b.47.1.2 (A:) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} iiggresrphsrpymaylqiqspagqsrcggflvredfvltaahcwgsninvtlgahniq rrentqqhitarrairhpqynqrtiqndimllqlsrrvrrnrnvnpvalpraqeglrpgt lctvagwgrvsmrrgtdtlrevqlrvqrdrqclrifgsydprrqicvgdrrerkaafkgd sggpllcnnvahgivsygkssgvppevftrvssflpwirttmrs
Timeline for d1cgha_: