Lineage for d1cgha_ (1cgh A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795058Protein Cathepsin G [50548] (1 species)
  7. 2795059Species Human (Homo sapiens) [TaxId:9606] [50549] (4 PDB entries)
  8. 2795060Domain d1cgha_: 1cgh A: [26290]
    complexed with 1zg

Details for d1cgha_

PDB Entry: 1cgh (more details), 1.8 Å

PDB Description: Human cathepsin G
PDB Compounds: (A:) cathepsin G

SCOPe Domain Sequences for d1cgha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgha_ b.47.1.2 (A:) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]}
iiggresrphsrpymaylqiqspagqsrcggflvredfvltaahcwgsninvtlgahniq
rrentqqhitarrairhpqynqrtiqndimllqlsrrvrrnrnvnpvalpraqeglrpgt
lctvagwgrvsmrrgtdtlrevqlrvqrdrqclrifgsydprrqicvgdrrerkaafkgd
sggpllcnnvahgivsygkssgvppevftrvssflpwirttmrs

SCOPe Domain Coordinates for d1cgha_:

Click to download the PDB-style file with coordinates for d1cgha_.
(The format of our PDB-style files is described here.)

Timeline for d1cgha_: