Lineage for d1cfaa_ (1cfa A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714706Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2714707Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) (S)
  5. 2714708Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins)
    can be classified as disulfide-rich
    Pfam PF01821
  6. 2714712Protein C5a anaphylotoxin [47688] (2 species)
  7. 2714713Species Human (Homo sapiens) [TaxId:9606] [47689] (5 PDB entries)
  8. 2714722Domain d1cfaa_: 1cfa A: [17793]
    semisynthetic antagonist
    protein/RNA complex

Details for d1cfaa_

PDB Entry: 1cfa (more details)

PDB Description: solution structure of a semi-synthetic c5a receptor antagonist at ph 5.2, 303k, nmr, 20 structures
PDB Compounds: (A:) complement 5a semi-synthetic antagonist

SCOPe Domain Sequences for d1cfaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cfaa_ a.50.1.1 (A:) C5a anaphylotoxin {Human (Homo sapiens) [TaxId: 9606]}
mlqkkieeiaakykhsvvkkccydgasvnndetceqraarislgprcikafteccvvasq
lranishkdmc

SCOPe Domain Coordinates for d1cfaa_:

Click to download the PDB-style file with coordinates for d1cfaa_.
(The format of our PDB-style files is described here.)

Timeline for d1cfaa_: