Lineage for d1cf9a2 (1cf9 A:27-597)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015076Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 3015077Superfamily e.5.1: Heme-dependent catalase-like [56634] (3 families) (S)
  5. 3015078Family e.5.1.1: Heme-dependent catalases [56635] (3 proteins)
  6. 3015167Protein Catalase II [56642] (1 species)
    contains additional flavodoxin-like domain at C-terminus
  7. 3015168Species Escherichia coli, HPII [TaxId:562] [56643] (17 PDB entries)
  8. 3015217Domain d1cf9a2: 1cf9 A:27-597 [42815]
    Other proteins in same PDB: d1cf9a1, d1cf9b1, d1cf9c1, d1cf9d1
    complexed with hem; mutant

Details for d1cf9a2

PDB Entry: 1cf9 (more details), 1.8 Å

PDB Description: structure of the mutant val169cys of catalase hpii from escherichia coli
PDB Compounds: (A:) protein (catalase hpii)

SCOPe Domain Sequences for d1cf9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf9a2 e.5.1.1 (A:27-597) Catalase II {Escherichia coli, HPII [TaxId: 562]}
dslapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgv
riaddqnslragsrgptlledfilrekithfdheriperivhargsaahgyfqpykslsd
itkadflsdpnkitpvfvrfstcqggagsadtvrdirgfatkfyteegifdlvgnntpif
fiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsy
rtmegfgihtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweai
eagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaen
eqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnfheipinrptcpyhnfqrd
gmhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyys
hprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgiel
tddqlnitpppdvnglkkdpslslyaipdgd

SCOPe Domain Coordinates for d1cf9a2:

Click to download the PDB-style file with coordinates for d1cf9a2.
(The format of our PDB-style files is described here.)

Timeline for d1cf9a2: