Lineage for d1cdka_ (1cdk A:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
members organized in the groups and subfamiles specified by the comments
Protein cAMP-dependent PK, catalytic subunit [56116] (5 species)
AGC group; PKA subfamily; serine/threonine kinase
Species Pig (Sus scrofa) [TaxId:9823] [56117] (9 PDB entries) 
Domain d1cdka_: 1cdk A: [41620]
complexed with anp, mn, myr
Details for d1cdka_
PDB Entry: 1cdk (more details), 2 Å
PDB Description: camp-dependent protein kinase catalytic subunit (e.c.2.7.1.37) (protein kinase a) complexed with protein kinase inhibitor peptide fragment 5-24 (pki(5-24) isoelectric variant ca) and mn2+ adenylyl imidodiphosphate (mnamp-pnp) at ph 5.6 and 7c and 4c
PDB Compounds: (A:) cAMP-DEPENDENT PROTEIN KINASESCOPe Domain Sequences for d1cdka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cdka_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Pig (Sus scrofa) [TaxId: 9823]}
kgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhketgn
hfamkildkqkvvklkqiehtlnekrilqavnfpflvkleysfkdnsnlymvmeyvpgge
mfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgf
akrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiy
ekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfattdwiaiyq
rkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
SCOPe Domain Coordinates for d1cdka_:
Click to download the PDB-style file with coordinates for d1cdka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cdka_:
- d1cdka_ first appeared (with stable ids) in SCOP 1.55
- d1cdka_ appears in SCOPe 2.03
- d1cdka_ appears in SCOPe 2.05
- d1cdka_ appears in the current release, SCOPe 2.08
View in 3D
