Lineage for d1cdi_1 (1cdi 0-97)
- Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strandsSuperfamily b.1.1: Immunoglobulin [48726] (4 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins) 
Protein CD4 V-set domains [48737] (2 species) Species Human (Homo sapiens) [TaxId:9606] [48738] (15 PDB entries) 
Domain d1cdi_1: 1cdi 0-97 [19727]
Other proteins in same PDB: d1cdi_2
domain 1
Details for d1cdi_1
PDB Entry: 1cdi (more details), 2.9 Å
PDB Description: structures of an hiv and mhc binding fragment from human cd4 as refined in two crystal lattices
SCOP Domain Sequences for d1cdi_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cdi_1 b.1.1.1 (0-97) CD4 V-set domains {Human (Homo sapiens)}
tkkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrr
slwdqgnfpliiknlkiedsdtyicevedqkeevqllv
SCOP Domain Coordinates for d1cdi_1:
Click to download the PDB-style file with coordinates for d1cdi_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cdi_1:
- d1cdi_1 first appeared (with stable ids) in SCOP 1.55
- d1cdi_1 appears in SCOP 1.69
- d1cdi_1 is called d1cdia1 in SCOP 1.73
- d1cdi_1 appears in the current release, SCOPe 2.08, called d1cdia1
View in 3D
