![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein CD1, alpha-3 domain [88615] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88616] (6 PDB entries) |
![]() | Domain d1cd1a1: 1cd1 A:186-279 [21579] Other proteins in same PDB: d1cd1a2, d1cd1b_, d1cd1c2, d1cd1d_ |
PDB Entry: 1cd1 (more details), 2.67 Å
SCOP Domain Sequences for d1cd1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cd1a1 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw ylqatldveageeaglacrvkhsslggqdiilyw
Timeline for d1cd1a1:
![]() Domains from other chains: (mouse over for more information) d1cd1b_, d1cd1c1, d1cd1c2, d1cd1d_ |