| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.3: C2 set domains [49142] (8 proteins) |
| Protein CD2-binding domain of CD58, second domain [49155] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49156] (1 PDB entry) |
| Domain d1ccza2: 1ccz A:94-171 [21683] Other proteins in same PDB: d1ccza1 complexed with nag |
PDB Entry: 1ccz (more details), 1.8 Å
SCOP Domain Sequences for d1ccza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ccza2 b.1.1.3 (A:94-171) CD2-binding domain of CD58, second domain {Human (Homo sapiens) [TaxId: 9606]}
emvskpmiywecsnatltcevlegtdvelklyqgkehlrslrqktmsyqwtnlrapfkck
avnrvsqesemevvncpe
Timeline for d1ccza2: