Lineage for d1cc0a_ (1cc0 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867786Protein RhoA [52612] (1 species)
  7. 2867787Species Human (Homo sapiens) [TaxId:9606] [52613] (39 PDB entries)
    Uniprot P61586 2-181
  8. 2867848Domain d1cc0a_: 1cc0 A: [32050]
    Other proteins in same PDB: d1cc0e_, d1cc0f_
    complexed with gdp, mg

Details for d1cc0a_

PDB Entry: 1cc0 (more details)

PDB Description: crystal structure of the rhoa.gdp-rhogdi complex
PDB Compounds: (A:) transforming protein rhoa

SCOPe Domain Sequences for d1cc0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cc0a_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]}
irkklvivgdgacgktcllivnskdqfpevyvptvfenyvadievdgkqvelalwdtagq
edydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrn
dehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqarr
gkkksgc

SCOPe Domain Coordinates for d1cc0a_:

Click to download the PDB-style file with coordinates for d1cc0a_.
(The format of our PDB-style files is described here.)

Timeline for d1cc0a_: