Lineage for d1cbfa_ (1cbf A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1877645Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 1877646Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 1877647Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
    Pfam PF00590
  6. 1877648Protein Cobalt precorrin-4 methyltransferase CbiF [53792] (1 species)
  7. 1877649Species Bacillus megaterium [TaxId:1404] [53793] (2 PDB entries)
  8. 1877650Domain d1cbfa_: 1cbf A: [35587]
    complexed with po4, sah

Details for d1cbfa_

PDB Entry: 1cbf (more details), 2.4 Å

PDB Description: the x-ray structure of a cobalamin biosynthetic enzyme, cobalt precorrin-4 methyltransferase, cbif
PDB Compounds: (A:) cobalt-precorrin-4 transmethylase

SCOPe Domain Sequences for d1cbfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cbfa_ c.90.1.1 (A:) Cobalt precorrin-4 methyltransferase CbiF {Bacillus megaterium [TaxId: 1404]}
glvprgshmklyiigagpgdpdlitvkglkllqqadvvlyadslvsqdliakskpgaevl
ktagmhleemvgtmldrmregkmvvrvhtgdpamygaimeqmvllkregvdieivpgvts
vfaaaaaaeaeltipdltqtviltraegrtpvpefekltdlakhkctialflsstltkkv
mkefinagwsedtpvvvvykatwpdekivrttvkdlddamrtngirkqamilagwaldp

SCOPe Domain Coordinates for d1cbfa_:

Click to download the PDB-style file with coordinates for d1cbfa_.
(The format of our PDB-style files is described here.)

Timeline for d1cbfa_: