Lineage for d1c9qa_ (1c9q A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1067283Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 1067284Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) (S)
  5. 1067285Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 1067331Protein BIR domains of XIAP [57928] (1 species)
  7. 1067332Species Human (Homo sapiens) [TaxId:9606] [57929] (14 PDB entries)
    Uniprot P98170 241-356
  8. 1067360Domain d1c9qa_: 1c9q A: [45377]
    BIR2 domain
    complexed with zn

Details for d1c9qa_

PDB Entry: 1c9q (more details)

PDB Description: average nmr solution structure of the bir-2 domain of xiap
PDB Compounds: (A:) apoptosis inhibitor iap homolog

SCOPe Domain Sequences for d1c9qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9qa_ g.52.1.1 (A:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]}
rdhfaldrpsethadyllrtgqvvdisdtiyprnpamyseearlksfqnwpdyahltpre
lasaglyytgigdqvqcfacggklknwepgdrawsehrrhfpncffvlgrnlnirse

SCOPe Domain Coordinates for d1c9qa_:

Click to download the PDB-style file with coordinates for d1c9qa_.
(The format of our PDB-style files is described here.)

Timeline for d1c9qa_: