Lineage for d1c9oa_ (1c9o A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) 
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
barrel, closed; n=5, S=8Protein Major cold shock protein [50283] (4 species) Species Bacillus caldolyticus [TaxId:1394] [50286] (7 PDB entries) 
Domain d1c9oa_: 1c9o A: [25325]
complexed with na, trs
Details for d1c9oa_
PDB Entry: 1c9o (more details), 1.17 Å
PDB Description: crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp
PDB Compounds: (A:) cold-shock proteinSCOPe Domain Sequences for d1c9oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c9oa_ b.40.4.5 (A:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]}
mqrgkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
anvvkl
SCOPe Domain Coordinates for d1c9oa_:
Click to download the PDB-style file with coordinates for d1c9oa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c9oa_:
- d1c9oa_ first appeared (with stable ids) in SCOP 1.55
- d1c9oa_ appears in SCOPe 2.04
- d1c9oa_ appears in SCOPe 2.06
- d1c9oa_ appears in the current release, SCOPe 2.08
View in 3D
