Lineage for d1c9ma_ (1c9m A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873305Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2873306Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2873307Family c.41.1.1: Subtilases [52744] (15 proteins)
  6. 2873525Protein Subtilisin [52745] (7 species)
  7. 2873585Species Bacillus lentus [TaxId:1467] [52750] (9 PDB entries)
  8. 2873592Domain d1c9ma_: 1c9m A: [32506]
    complexed with ca, so4

Details for d1c9ma_

PDB Entry: 1c9m (more details), 1.67 Å

PDB Description: bacillus lentus subtilsin (ser 87) n76d/s103a/v104i
PDB Compounds: (A:) serine protease

SCOPe Domain Sequences for d1c9ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9ma_ c.41.1.1 (A:) Subtilisin {Bacillus lentus [TaxId: 1467]}
aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
ghgthvagtiaaldnsigvlgvapsaelyavkvlgasgsgaissiaqglewagnngmhva
nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi
rnhlkntatslgstnlygsglvnaeaatr

SCOPe Domain Coordinates for d1c9ma_:

Click to download the PDB-style file with coordinates for d1c9ma_.
(The format of our PDB-style files is described here.)

Timeline for d1c9ma_: