Lineage for d1c8qa1 (1c8q A:404-496)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
folded sheet; greek-keySuperfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) 
this domain is C-terminal to the catalytic beta/alpha barrel domainFamily b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
this domain follows the catalytic beta/alpha barrel domain
Protein Animal alpha-amylase [51024] (3 species) Species Human (Homo sapiens) [TaxId:9606] [51026] (53 PDB entries)
Uniprot P04746 16-511 ! SQ 04746
Domain d1c8qa1: 1c8q A:404-496 [59087]
Other proteins in same PDB: d1c8qa2
complexed with ca, cl
Details for d1c8qa1
PDB Entry: 1c8q (more details), 2.3 Å
PDB Description: structure solution and refinement of the recombinant human salivary amylase
PDB Compounds: (A:) alpha-amylaseSCOPe Domain Sequences for d1c8qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c8qa1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
qpftnwydngsnqvafgrgnrgfivfnnddwtfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl
SCOPe Domain Coordinates for d1c8qa1:
Click to download the PDB-style file with coordinates for d1c8qa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c8qa1:
- d1c8qa1 first appeared in SCOP 1.57
- d1c8qa1 appears in SCOPe 2.02
- d1c8qa1 appears in SCOPe 2.04
- d1c8qa1 appears in the current release, SCOPe 2.08
View in 3D
