Lineage for d1c8qa1 (1c8q A:404-496)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675781Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 675782Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 675783Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 675812Protein Animal alpha-amylase [51024] (3 species)
  7. 675813Species Human (Homo sapiens) [TaxId:9606] [51026] (33 PDB entries)
  8. 675842Domain d1c8qa1: 1c8q A:404-496 [59087]
    Other proteins in same PDB: d1c8qa2
    complexed with ca, cl

Details for d1c8qa1

PDB Entry: 1c8q (more details), 2.3 Å

PDB Description: structure solution and refinement of the recombinant human salivary amylase
PDB Compounds: (A:) alpha-amylase

SCOP Domain Sequences for d1c8qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c8qa1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
qpftnwydngsnqvafgrgnrgfivfnnddwtfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

SCOP Domain Coordinates for d1c8qa1:

Click to download the PDB-style file with coordinates for d1c8qa1.
(The format of our PDB-style files is described here.)

Timeline for d1c8qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c8qa2